PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG211600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family TALE
Protein Properties Length: 460aa    MW: 48981.1 Da    PI: 7.0795
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG211600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.3e-093964341854
                          HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          +Fe+   +yp+ +e+e LA++ gL+ +qV++WF N R +
  Pavir.4NG211600.1.p 396 MFENflRPYPKDNEKEMLAERSGLSRSQVSNWFINARVR 434
                          57766689*****************************88 PP

2BELL21.65.3e-08267335272
                 BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          ++++qk k+   +ll+ +d+r +q+v+++q  +  +  ++g g+  + + +A +a+S  +r L+ +i++ i
  Pavir.4NG211600.1.p 267 EHAHQKLKNDFQKLLQLLDQRCNQCVDKIQSAACKYGGMVGGGA--LLAPFAHRAVSAAHRRLRARITGEI 335
                          6889999999999****************************999..99*******************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005740.008197333IPR006563POX domain
PfamPF075261.9E-15209332IPR006563POX domain
PROSITE profilePS5007112.163375438IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.6E-26377450IPR009057Homeodomain-like
SMARTSM003891.5E-7378442IPR001356Homeobox domain
SuperFamilySSF466893.25E-16378447IPR009057Homeodomain-like
CDDcd000865.09E-12378439No hitNo description
PfamPF059205.6E-16395434IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MTGNASYQQL GLGVDAMMSG CFVSGGADTQ VFHDGSFFGF GEPADVAASF LVDGGSMLTG  60
QLQLVRAAAT QSVSLEEMRG GGGYGPSPSD VTVAHAPKVA AKLAGEMETS WIHEPYYGTT  120
WFSGDGLRDP FAAAASELSL RLRAESLPAA GAVNINLQDQ SSEVSCSGLT HASSSSAAGS  180
VFQTPCGGGD MARLGPLHFS QVLPRWPGYA HVTQQTLDEF VACLLQDVAV FAGSAGGGEA  240
SCPLPTSSSS KTTSSNASAF LGSESEEHAH QKLKNDFQKL LQLLDQRCNQ CVDKIQSAAC  300
KYGGMVGGGA LLAPFAHRAV SAAHRRLRAR ITGEIAAASR RGAPPSLTLA DRERSWESAF  360
IQKHWALRQL RRGDQQSWRP QRGLPEKSVA VLKAWMFENF LRPYPKDNEK EMLAERSGLS  420
RSQVSNWFIN ARVRLWKPMI EEMYEDLKKA SGGGEGVAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2dmn_A3e-133844531483Homeobox protein TGIF2LX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.148840.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700583.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_012700584.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_012700585.10.0PREDICTED: homeobox protein ATH1-like
TrEMBLK3XWQ00.0K3XWQ0_SETIT; Uncharacterized protein
STRINGSi006358m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31433365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.19e-55homeobox gene 1